PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A01G1288
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family Trihelix
Protein Properties Length: 388aa    MW: 44412.6 Da    PI: 7.797
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A01G1288genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix79.16.4e-2555124271
     trihelix   2 WtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkr 71 
                  W ++e++ Li +r+em+ r++++k++k+lWe++s+ mr++gf rsp++C++kw+nl k++kk k+++++ 
  Gh_A01G1288  55 WVQDETRSLIGFRKEMDGRFNTSKSNKHLWEKISAMMRKKGFDRSPTMCTDKWRNLLKEFKKAKHQDRGS 124
                  *****************************************************************99974 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.1E-445116IPR009057Homeodomain-like
PROSITE profilePS500908.26947111IPR017877Myb-like domain
SMARTSM007172.6E-451113IPR001005SANT/Myb domain
CDDcd122034.59E-2853118No hitNo description
PfamPF138371.1E-1854136No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 388 aa     Download sequence    Send to blast
MARDMIIEVT TNGGLPDHLR HHHPHSLQQQ QQMILGESSG DDPEVKAPKK RAETWVQDET  60
RSLIGFRKEM DGRFNTSKSN KHLWEKISAM MRKKGFDRSP TMCTDKWRNL LKEFKKAKHQ  120
DRGSGSVKIT YKEIEEILRE RTKKPYKAPT PPPKLDSFMH FSDKGLCFED TSITFGPLEG  180
MLLLLLPSGR PALNLEQGLD HDGHPLAITT ANAVAVSGVP PWNWRETPGN GGDRLPYGGR  240
VITVKYRDYA QRIGIDGTAE AIREAIKSAF RLRTKRAFWL EDEDHIIRSL DGEMPLGNYT  300
LHLDEGLAVK VCLYDVSDHI PVHTEEKIFY TEDDYREYLV LRGYVGLKEI DGYRNINSMD  360
DLQTNTIYRG VSWKLLHLEG LYNRVALP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2jmw_A5e-4449131183DNA binding protein GT-1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKU8964138e-35KU896413.1 Hibiscus cannabinus microsatellite HC_ES_37_CTC sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012467487.10.0PREDICTED: trihelix transcription factor GT-1-like isoform X1
SwissprotQ9FX531e-174TGT1_ARATH; Trihelix transcription factor GT-1
TrEMBLA0A0B0N3620.0A0A0B0N362_G
STRINGGLYMA11G37390.20.0(Glycine max)
STRINGGLYMA18G01360.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28912768
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13450.11e-157Trihelix family protein